Table Of Contents
- Latest Update
- Applications Description
- How to install Nasser Al Qatami Quran MP3 offline & read APK for Android?
- How to install Nasser Al Qatami Quran MP3 offline & read APK for PC (Windows 7/8/10 or MAC)?
- Nasser Al Qatami Quran MP3 offline & read Pros & Cons
- Nasser Al Qatami Quran MP3 offline & read related applications
Latest update [menu]
Thanks for choosing Afnan Soft! This release includes:
• Listen to Holy Quran.
• Or Read from Mushaf.
• Or Listen and browse the Quran at the same time.
• New Quran script (Hafs Font).
• Arabic and English languages suppored.
• Instructions for use added.
• Made light and easy for the mobile to handle.
• Stability and speedy performance improvement.
Description [menu]
Some features of the app :
- Toggle between playing single surah or all surahs In sequence.
- Recitation pauses automatically in the event of receiving a phone call.
- Contains instructions for use.
Do not hesitate to download the app now and be one of the first
How to install Nasser Al Qatami Quran MP3 offline & read APK for Android [menu]
Download Nasser Al Qatami Quran MP3 offline & read APK file (com.afnansoftsystems.nasseralqatamienglishpic_10_100767343.apk) from SameAPK.com, then follow these steps:
Update Phone Settings
- Go to your phone Settings page
- Tap Security or Applications (varies with device)
- Check the Unknown Sources box
- Confirm with OK
Go to Downloads
- Open Downloads on your device by going to My Files or Files
- Tap the APK file you downloaded (com.afnansoftsystems.nasseralqatamienglishpic_10_100767343.apk)
- Tap Install when prompted, the APK file you downloaded will be installed on your device.
How to install Nasser Al Qatami Quran MP3 offline & read APK on Windows 7/8/10 or MAC PC? [menu]
Download Nasser Al Qatami Quran MP3 offline & read APK file(com.afnansoftsystems.nasseralqatamienglishpic_10_100767343.apk) from SameAPK.com to your PC (ex: /Users/xxx/Downloads/(com.afnansoftsystems.nasseralqatamienglishpic_10_100767343.apk)), then follow these steps:
Using Emulator:
- Download And Install one Emulator Softwares (Ex: Bluestacks, GenyMotion, NoxPlayer)
- Simple install APK on PC by drag and drop file com.afnansoftsystems.nasseralqatamienglishpic_10_100767343.apk on Emulator screen
Nasser Al Qatami Quran MP3 offline & read APK Pros & Cons [menu]
Pros
- This app is safe, it's not require high risk permissions
- Compatible with 32 bit device (most Emulator using 32bit arch CPU)
- Compatible with 64-bit device (some android device and current Bluestacks)
Cons
Everything is good.