Nasser Al Qatami Quran MP3 offline & read APK

12+ votes, 4.75/5

Listen to the Holy Quran or read from the Mus-haf, or both at the same time... [readmore]


⇣ Download APK (96.10 MB)

This is an original APK file direct fetch from google play. It is safe to download and free of any virus.

Version 1.10
Update
Size 96.10 MB
Category Music & Audio
Developer AFNAN SOFT SYSTEMS
Downloads ↓ 1.3K
⇣ Download APK (96.10 MB)

This is an original APK file direct fetch from google play. It is safe to download and free of any virus.

File Infos

License type Free
Version 1.10
Size 96.10 MB (100767343)
Filename com.afnansoftsystems.nasseralqatamienglishpic_10_100767343.apk
Requirement 4.1 and up
Type app
Category Music & Audio
Package name: com.afnansoftsystems.nasseralqatamienglishpic
Slogan: Listen to the Holy Quran or read from the Mus-haf, or both at the same time

APK Permissions


‣ android.permission.INTERNET
‣ android.permission.ACCESS_NETWORK_STATE
‣ android.permission.WAKE_LOCK


APK used Features


‣ android.hardware.touchscreen

Screenshots (8 images)


About Nasser Al Qatami Quran MP3 offline & read APK

Nasser Al Qatami Quran MP3 offline & read APK version 1.10 poster

Latest update [menu]


Thanks for choosing Afnan Soft! This release includes:
• Listen to Holy Quran.
• Or Read from Mushaf.
• Or Listen and browse the Quran at the same time.
• New Quran script (Hafs Font).
• Arabic and English languages suppored.
• Instructions for use added.
• Made light and easy for the mobile to handle.
• Stability and speedy performance improvement.

Description [menu]


Some features of the app :
- Toggle between playing single surah or all surahs In sequence.
- Recitation pauses automatically in the event of receiving a phone call.
- Contains instructions for use.

Do not hesitate to download the app now and be one of the first

How to install Nasser Al Qatami Quran MP3 offline & read APK for Android [menu]


Download Nasser Al Qatami Quran MP3 offline & read APK file (com.afnansoftsystems.nasseralqatamienglishpic_10_100767343.apk) from SameAPK.com, then follow these steps:

Update Phone Settings

  • Go to your phone Settings page
  • Tap Security or Applications (varies with device)
  • Check the Unknown Sources box
  • Confirm with OK

Go to Downloads

  • Open Downloads on your device by going to My Files or Files
  • Tap the APK file you downloaded (com.afnansoftsystems.nasseralqatamienglishpic_10_100767343.apk)
  • Tap Install when prompted, the APK file you downloaded will be installed on your device.

How to install Nasser Al Qatami Quran MP3 offline & read APK on Windows 7/8/10 or MAC PC? [menu]


Download Nasser Al Qatami Quran MP3 offline & read APK file(com.afnansoftsystems.nasseralqatamienglishpic_10_100767343.apk) from SameAPK.com to your PC (ex: /Users/xxx/Downloads/(com.afnansoftsystems.nasseralqatamienglishpic_10_100767343.apk)), then follow these steps:

Using Emulator:

  • Download And Install one Emulator Softwares (Ex: Bluestacks, GenyMotion, NoxPlayer)
  • Simple install APK on PC by drag and drop file com.afnansoftsystems.nasseralqatamienglishpic_10_100767343.apk on Emulator screen

Nasser Al Qatami Quran MP3 offline & read APK Pros & Cons [menu]


Pros
  • This app is safe, it's not require high risk permissions
  • Compatible with 32 bit device (most Emulator using 32bit arch CPU)
  • Compatible with 64-bit device (some android device and current Bluestacks)

Cons
Everything is good.


Similar applications [menu]


New Apps